DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dp1 and bicc1b

DIOPT Version :9

Sequence 1:NP_001286573.1 Gene:Dp1 / 37116 FlyBaseID:FBgn0027835 Length:1301 Species:Drosophila melanogaster
Sequence 2:XP_700087.4 Gene:bicc1b / 571411 ZFINID:ZDB-GENE-080522-3 Length:850 Species:Danio rerio


Alignment Length:249 Identity:66/249 - (26%)
Similarity:106/249 - (42%) Gaps:56/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   608 HKFVIGKGGANIKKIRDETQTKIDLPAEGDTNEV-----IVITGKKENVLEAKERIQK-----IQ 662
            |..||||||.||||:.::|...|..|.....|:.     :.|.|:...|..|:.||::     :.
Zfish    22 HSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPGGVEAARARIRELLPLVLM 86

  Fly   663 NELSDIV-------TEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGP 720
            .||..||       :..:|...:.||  |....|..|.:....|                .:||.
Zfish    87 FELPVIVQLNPDPSSPAIQHISQTYN--ISVAFKQRSRLYGATG----------------VVRGS 133

  Fly   721 KDD---VEKAKVQLLE--LANERQLASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFPS 780
            :::   |::....|||  ..|.....:.:.::....|||.|::|:||::|:.|...|||::.||.
Zfish   134 QNNAAAVKRGTAVLLEHLAGNLASAITISTQLDIAPQHHLFMMGRNGSNIKHIMQRTGAQVHFPD 198

  Fly   781 -NEDTDKEVITIIGKEESVKKAREQLEAI--------IKECDEVTEGEVSVDPK 825
             |....|..:.:.|..:||..||:.|...        |||       ::.|:|:
Zfish   199 PNCPQKKSTVYVQGTIDSVCLARQYLMGCLPLVLMFDIKE-------DIEVEPQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dp1NP_001286573.1 vigilin_like_KH 170..231 CDD:239087
vigilin_like_KH 242..>290 CDD:239087
vigilin_like_KH 315..373 CDD:239087
vigilin_like_KH 384..440 CDD:239087
vigilin_like_KH 454..513 CDD:239087
vigilin_like_KH 524..586 CDD:239087
vigilin_like_KH 598..659 CDD:239087 20/55 (36%)
vigilin_like_KH 670..732 CDD:239087 10/64 (16%)
vigilin_like_KH 744..806 CDD:239087 21/62 (34%)
vigilin_like_KH 817..879 CDD:239087 2/9 (22%)
vigilin_like_KH 890..989 CDD:239087
vigilin_like_KH 995..1055 CDD:239087
vigilin_like_KH 1075..1137 CDD:239087
vigilin_like_KH 1149..1208 CDD:239087
bicc1bXP_700087.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.