DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dp1 and BicC

DIOPT Version :9

Sequence 1:NP_001286573.1 Gene:Dp1 / 37116 FlyBaseID:FBgn0027835 Length:1301 Species:Drosophila melanogaster
Sequence 2:NP_476865.1 Gene:BicC / 34946 FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster


Alignment Length:505 Identity:104/505 - (20%)
Similarity:195/505 - (38%) Gaps:116/505 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   612 IGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGK--KENVLEA-KERIQKIQNELSDIVTEEV 673
            :|.|..:      |||::|. ..:.|.:::..|..|  .:|..:. .||.:..:.:|..::..|.
  Fly    48 VGSGAPS------ETQSEIS-SVDSDWSDIRAIAMKLGVQNPDDLHTERFKVDRQKLEQLIKAES 105

  Fly   674 QI-----PPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGPKDDVEKAKVQLLE 733
            .|     ...:::.|:.|....:|   ..|   .:|......|...|.|.|..|.|::||.::|.
  Fly   106 SIEGMNGAEYFFHDIMNTTDTYVS---WPC---RLKIGAKSKKDPHVRIVGKVDQVQRAKERILS 164

  Fly   734 LANERQL-------ASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFP----SNEDTDKE 787
            ..:.|..       .|:|        .|.::||:.|.:|::|.|.|...|.||    ||......
  Fly   165 SLDSRGTRVIMKMDVSYT--------DHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSN 221

  Fly   788 VITIIGKEESVKKAREQLE---AIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGVM 849
            .:::.|..|.|::||..:.   .::...:....|.....|.|...::        ::.|....|.
  Fly   222 QVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYI--------KMIETKFNVQ 278

  Fly   850 ISF-PRVGINSDKVTIKGAKDCIEAARQR----------IEEIVADLEAQTTIEVVIPQRHHRTI 903
            :.| .|..:::..|.:||::.  |:|:.|          .|.|.:.:.....:| :.|| ||..:
  Fly   279 VIFSTRPKLHTSLVLVKGSEK--ESAQVRDATQLLINFACESIASQILVNVQME-ISPQ-HHEIV 339

  Fly   904 MGARGFKVQQVTFEFDVQIKFPDRDATEPVEGLTNGGSGENGGENEGQEGEQEVEKEAEQEPVRQ 968
            .|.....:..:......:|.|||.                               .:...:|:::
  Fly   340 KGKNNVNLLSIMERTQTKIIFPDL-------------------------------SDMNVKPLKK 373

  Fly   969 CDVIRITGRIEKCEAAKQALLDLIPIEEELSVPFDLHRTIIGPRGANVRQFMSKHDVHVELPPSE 1033
            ..| .|:|||:....|:|.||..:|:......| |.|..     .:.:....:|:.|::.|...:
  Fly   374 SQV-TISGRIDDVYLARQQLLGNLPVALIFDFP-DNHND-----ASEIMSLNTKYGVYITLRQKQ 431

  Fly  1034 LKSDV-IKVCGTPA---RVAEAREALVKM--------IEDYEADRADREL 1071
            .:|.: |.|.|...   ::.|||:.::::        |.||.....|::|
  Fly   432 RQSTLAIVVKGVEKFIDKIYEARQEILRLATPFVKPEIPDYYFMPKDKDL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dp1NP_001286573.1 vigilin_like_KH 170..231 CDD:239087
vigilin_like_KH 242..>290 CDD:239087
vigilin_like_KH 315..373 CDD:239087
vigilin_like_KH 384..440 CDD:239087
vigilin_like_KH 454..513 CDD:239087
vigilin_like_KH 524..586 CDD:239087
vigilin_like_KH 598..659 CDD:239087 12/49 (24%)
vigilin_like_KH 670..732 CDD:239087 15/66 (23%)
vigilin_like_KH 744..806 CDD:239087 19/65 (29%)
vigilin_like_KH 817..879 CDD:239087 13/72 (18%)
vigilin_like_KH 890..989 CDD:239087 18/98 (18%)
vigilin_like_KH 995..1055 CDD:239087 13/63 (21%)
vigilin_like_KH 1075..1137 CDD:239087
vigilin_like_KH 1149..1208 CDD:239087
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 20/73 (27%)
vigilin_like_KH 327..393 CDD:239087 18/99 (18%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.