DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and sspA

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:205 Identity:43/205 - (20%)
Similarity:74/205 - (36%) Gaps:61/205 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSD 83
            ::.||..|:.:|   |..:.|:....:.:..||..:||||.|....:|:|..|..||       |
E. coli    26 RIVLAEKGVSFE---IEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYL-------D 80

  Fly    84 TLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLF--ATGQTTIPKERYDAVIEIYDFVETFL 146
            ..:|...|.                         |::  |.|::.:...|.:.  :.|..:.|.:
E. coli    81 ERFPHPPLM-------------------------PVYPVARGESRLYMHRIEK--DWYTLMNTII 118

  Fly   147 TGHDFIAGDQLTIADFSLITSITALA------------VFVVIDTVKYANITAWIKRIEELPYYE 199
            .|    :..:...|...|...:.|:|            .|.::|.  |.....|  |:.:|..  
E. coli   119 NG----SASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDC--YLAPLLW--RLPQLGI-- 173

  Fly   200 EACGKGARDL 209
            |..|.||::|
E. coli   174 EFSGPGAKEL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 42/203 (21%)
sspANP_417696.1 sspA 1..211 CDD:236537 43/205 (21%)

Return to query results.
Submit another query.