DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTO1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:198 Identity:51/198 - (25%)
Similarity:80/198 - (40%) Gaps:20/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPE-FLRKNPQHTVPTLED-DGHFIWDS 68
            :|.....|.....:|.|.|.||.:|.:.||...|    || |.:|||...||.||: .|..|::|
Human    26 IYSMRFCPFAERTRLVLKAKGIRHEVININLKNK----PEWFFKKNPFGLVPVLENSQGQLIYES 86

  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNG--LRGITKPLFATGQTTIPKER 131
            .....||...| ....|.|.|..::|.....|...|.|..:.|  :|...|..:|..:....|| 
Human    87 AITCEYLDEAY-PGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKE- 149

  Fly   132 YDAVIEIYDFVETFLTGH--DFIAGDQLTIADFSLITSITALAVFVVIDTVKYA-NITAWIKRIE 193
                   :..:|..||..  .|..|:.:::.|:.:......|....:.:.|.:. .:..|:..::
Human   150 -------FTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMK 207

  Fly   194 ELP 196
            |.|
Human   208 EDP 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 50/196 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/111 (19%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 25/71 (35%)