DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Clic5

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:163 Identity:40/163 - (24%)
Similarity:63/163 - (38%) Gaps:56/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSDTLYPKDLLQR--AV 95
            ||....:|||:||   |.|:......|        |:.....:.||:    :.|.|:..|:  |.
  Rat    87 KIEEFLEETLTPE---KYPKLAARHRE--------SNTAGIDIFSKF----SAYIKNTKQQNNAA 136

  Fly    96 VDQRLHFESGVVFVNGLRGITKPLFATG---QTTIPKERYDAVIEIYDFVETFLTGHD------F 151
            ::               ||:||.|....   .|.:|:|           ::|...|.:      |
  Rat   137 LE---------------RGLTKALRKLDDYLNTPLPEE-----------IDTNTHGDEKGSQRKF 175

  Fly   152 IAGDQLTIADFSLITSITALAVFVVIDTVKYAN 184
            :.||:||:||.:|:..:..    |.|...||.|
  Rat   176 LDGDELTLADCNLLPKLHV----VKIVAKKYRN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 40/163 (25%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 5/10 (50%)
O-ClC 14..249 CDD:129941 40/163 (25%)
G-site. /evidence=ECO:0000250|UniProtKB:O00299 32..35
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.