DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and CLIC3

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:228 Identity:48/228 - (21%)
Similarity:88/228 - (38%) Gaps:53/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRK-NPQHTVPTLEDDGHFIWDSHAISAYLV 76
            |..:...:.|...|:|:....::|    ..||:.|:. .|...:|.|      ::||.|.:..|.
Human    23 PSCQRLFMVLLLKGVPFTLTTVDT----RRSPDVLKDFAPGSQLPIL------LYDSDAKTDTLQ 77

  Fly    77 SKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDF 141
            .:....:||.|.|....|...:..:.....||......|..|:.|..:..     |..::.....
Human    78 IEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEAL-----YQQLLRALAR 137

  Fly   142 VETFLTG---HD-------------FIAGDQLTIADFSLITSITALAVFVVIDTV----KYANIT 186
            ::::|..   |:             |:.||:||:||.||:..:.      ::|||    :.|.|.
Human   138 LDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLH------IVDTVCAHFRQAPIP 196

  Fly   187 AWIKRIEELPYYEEACGKGARDLVTLLKKFNFT 219
            |.::.:..  |.:.|..:         |:|.:|
Human   197 AELRGVRR--YLDSAMQE---------KEFKYT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 43/203 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/64 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/137 (19%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 17/74 (23%)
PLN02817 5..229 CDD:330276 48/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.