DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GTT2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:56/204 - (27%)
Similarity:95/204 - (46%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGTEASPPVRAAKLTLAALGI--PYEYVKINTLAKETLSPEFLRKNPQHTVPTLE-DDGHF 64
            |:|:|.|.|.|.....::.||...:  ..::|:||....|...||||.||...|||.|| |||..
Yeast    18 KMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTL 82

  Fly    65 IWDSHAISAYLVSKYGQSDTLYPKDLLQRAVV---DQRLHFE----SGVVFVNGLRGITKPLFAT 122
            |.:..||:.|:.:..| :.||..|..|::.|:   ::|...|    ..|.|.:...|:...:...
Yeast    83 IAECTAITEYIDALDG-TPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEVELY 146

  Fly   123 GQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITA 187
            ........:.|..:....:.:|.|....::|||..::||.::|..:...|:..:....:...:.|
Yeast   147 QNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIVKLQVPEECEALRA 211

  Fly   188 WIKRIEELP 196
            |.||:::.|
Yeast   212 WYKRMQQRP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 54/201 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/75 (39%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/113 (19%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 29/74 (39%)
GST_C_GTT2_like 106..222 CDD:198291 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345142
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - oto99351
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.