DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF14

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:204 Identity:54/204 - (26%)
Similarity:93/204 - (45%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AAKLTLAALGIPYEYVKINTLAKETLSPEFLRK-NPQHTVPTLEDDGHFIWDSHAISAYLVSKYG 80
            ||...:...|:.:|.|.::.||.|..:..||.. ||...||.|||....:::..||:.||..:|.
plant    18 AALFCINEKGLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYK 82

  Fly    81 QSDT-LYPKDLLQRAVVDQRLHFESG-----------VVFVNGLRGITKPLFATGQTTIP--KER 131
            ...| |.|.|..:||::...:..:|.           .:.:|..:|:     ||..|.:.  ||:
plant    83 DVGTNLLPDDPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGL-----ATDDTAVQENKEK 142

  Fly   132 YDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDT-------VKYA--NITA 187
            ...|:.||   ||.|....::||:..::||...:..|..|     ::|       :.|:  |:.|
plant   143 LSEVLNIY---ETRLGESPYLAGESFSLADLHHLAPIDYL-----LNTDEEELKNLIYSRPNVAA 199

  Fly   188 WIKRIEELP 196
            |:::::..|
plant   200 WVEKMKMRP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 53/202 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/60 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/128 (22%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 21/61 (34%)
GST_C_Phi 94..214 CDD:198296 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.