DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and clic3

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:177 Identity:43/177 - (24%)
Similarity:69/177 - (38%) Gaps:52/177 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KINTLAKETLSPEFLRKNPQHTVPTL-------EDDGHFIWDSHAISAYLVS-KYGQSDTLYPKD 89
            ||....::||:|      ||:  |.|       ...|..|:  |..|||:.: ..|.:|.|..|.
Zfish    78 KIEEFLEDTLAP------PQY--PKLCCRYKESNTAGDDIF--HKFSAYIKNPNPGLNDMLEKKF 132

  Fly    90 LLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAG 154
            |.....:||.|                       .|.:|.| .|...|:     :..|.| ::.|
Zfish   133 LKSLMKLDQYL-----------------------LTPLPHE-LDQNPEL-----STSTRH-YLDG 167

  Fly   155 DQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEELPYYEEA 201
            :.|::||.:|:..:.  .|.||....:...|.|.:|.:.:  |.::|
Zfish   168 NALSLADCNLLPKLH--IVKVVCKKYRGFEIPAELKGLSK--YLDKA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 41/170 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/50 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/111 (21%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 6/19 (32%)
O-ClC 6..237 CDD:129941 43/177 (24%)
GST_C_CLIC3 99..231 CDD:198332 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.