DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF6

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:208 Identity:48/208 - (23%)
Similarity:89/208 - (42%) Gaps:18/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |:.:.::|..||...|...:.|....:.:|:|.:.....|.....|:.:||...||..||....|
plant     1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKI 65

  Fly    66 WDSHAISAYLVSKY---GQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLR----GITKPLFA-T 122
            ::|.||:.|:..::   |.:.....||:   |::...:..||......|.:    .:.|||:. |
plant    66 FESRAITQYIAHEFSDKGNNLLSTGKDM---AIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGMT 127

  Fly   123 GQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKY----A 183
            ...|:.:|....:.::.|..|..|....::|.|..|:.|   :.:|..:...:...|.|.    .
plant   128 TDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVD---LHTIPVIQYLLGTPTKKLFDERP 189

  Fly   184 NITAWIKRIEELP 196
            :::||:..|...|
plant   190 HVSAWVADITSRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 46/203 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/115 (21%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 20/72 (28%)
GST_C_Phi 91..208 CDD:198296 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.