DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF5

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:219 Identity:52/219 - (23%)
Similarity:87/219 - (39%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHA 70
            :||...|...|.....|...|:.|:.:.:|.:|.:...|.||..||...||...|.|..:.:|.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    71 ISAYLVSKYGQSDTLYPKDLLQRAVVDQR----------------LHFESGVVFVNGLRGITKPL 119
            ||.|:.:.:....|........:.:..||                |.:|..:..:.||:...|.:
plant   131 ISEYIATVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMYGLKTDYKVV 195

  Fly   120 FATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDT----- 179
            ..|      :.:.:.|::||   |..|....|:|.:..|:||...:.:|..|     :||     
plant   196 NET------EAKLEKVLDIY---EERLKNSSFLASNSFTMADLYHLPNIQYL-----MDTHTKRM 246

  Fly   180 -VKYANITAWIKRIEELPYYEEAC 202
             |...::..|:..|...|.::.||
plant   247 FVNRPSVRRWVAEITARPAWKRAC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 49/211 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/70 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/134 (21%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 23/69 (33%)
GST_C_Phi 153..270 CDD:198296 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.