DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF7

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:216 Identity:50/216 - (23%)
Similarity:89/216 - (41%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |:.:.::|..||...|...:.|....:.:|:|.|.....|.....|:.:||...||..||....:
plant     1 MAGIKVFGHPASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKL 65

  Fly    66 WDSHAISAYLVSKY----GQSDTLYPKDLLQRAV-----------VDQRLHFESGVVFVNGLRGI 115
            ::|.||:.|:...|    .|..:|..||:...|:           |..:|.:|.          :
plant    66 FESRAITQYIAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQ----------V 120

  Fly   116 TKPLFA-TGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDT 179
            .|||:. |...|:.:|....:.::.|..|..|....::|.|:.|:.|   :.:|..:...:...|
plant   121 LKPLYGMTTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDKFTLVD---LHTIPVIQYLLGTPT 182

  Fly   180 VKY----ANITAWIKRIEELP 196
            .|.    .:::||:..|...|
plant   183 KKLFDERPHVSAWVADITSRP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 48/211 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/122 (20%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 20/72 (28%)
GST_C_Phi 95..209 CDD:198296 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.