DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Clic4

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:154 Identity:32/154 - (20%)
Similarity:62/154 - (40%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KINTLAKETL-SPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSDTLYPKDLLQR-AV 95
            ||....:|.| .|::|:.:|:|  |.....|..|:..  .|||:.:...:::....:.||:. ..
  Rat    90 KIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAK--FSAYIKNSRPEANEALERGLLKTLQK 150

  Fly    96 VDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIA 160
            :|:.|:                       :.:|.|     |:.....:...:...|:.||::|:|
  Rat   151 LDEYLN-----------------------SPLPGE-----IDENSMEDIKSSTRRFLDGDEMTLA 187

  Fly   161 DFSLITSITALAVFVVIDTVKYAN 184
            |.:|:..:.    .|.:...||.|
  Rat   188 DCNLLPKLH----IVKVVAKKYRN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 32/154 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/44 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 17/95 (18%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 4/10 (40%)
GST_N_CLIC 14..104 CDD:239359 5/13 (38%)
O-ClC 17..252 CDD:129941 32/154 (21%)
GST_C_family 111..251 CDD:295467 25/133 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.