DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTT2

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:219 Identity:65/219 - (29%)
Similarity:96/219 - (43%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWD 67
            ||.:|....|.|.||..:......|.::.:.|:...::.|||||...||...||.:.|....:::
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFE 66

  Fly    68 SHAISAYLVSKYGQ-SDTLYPKDLLQRAVVDQRLHFE--------SGVVFVNGLRGITKPLFATG 123
            ||||..||.|.|.. .|..||.||.:||.:...|.:.        ||.|    |..:..|  |.|
plant    67 SHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYV----LNSVLAP--ALG 125

  Fly   124 QTTIPK---ERYDAVIEIYDFVETF-LTGHD--FIAGDQLTIADFSLITSITALAVFVVIDTVK- 181
            ....||   |..:.:......:||| |.|..  .:.|.|.:|||.||:..:..|.|....|.:: 
plant   126 LPLNPKAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLRL 190

  Fly   182 ---YANITAWIK--RIEELPYYEE 200
               :..:..||:  |...:|:.:|
plant   191 LSPHKKVEQWIESTRKATMPHSDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 64/218 (29%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 25/74 (34%)
GST_C_Theta 92..221 CDD:198292 33/129 (26%)
NAM-associated 380..488 CDD:464129
DUF5401 <438..588 CDD:375164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.