DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTT3

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:243 Identity:71/243 - (29%)
Similarity:108/243 - (44%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWD 67
            ||.:|....|.|.||..:......|.::.:.|....::.|||||...||...||.:.|....:.:
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSE 66

  Fly    68 SHAISAYLVSKY-GQSDTLYPKDLLQRAVVDQRLHFE--------SGVVFVNGLRGITKPLFATG 123
            ||||..||.|.| ...|..||.||.:||.:...|.:.        :|.|    |..:..|  |.|
plant    67 SHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYV----LNSVLGP--ALG 125

  Fly   124 QTTIPKERYDA---VIEIYDFVETF-LTGHD-FIAG-DQLTIADFSLITSITALAVFVVIDTVK- 181
            ....||...:|   :.:....::|| |.|:. |:.| :|.:|||.||:..:|.|.|....|.:: 
plant   126 LPLNPKAAAEAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRL 190

  Fly   182 ---YANITAWIK--RIEELPYYEEA----------CGKGARDLVTLLK 214
               :.|:..||:  |...:|:::|.          |.| .|::.|..|
plant   191 LSPHKNVEQWIENTRKATMPHFDEVHEVLFRAKDRCQK-QREMATASK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 63/212 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/147 (25%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 62/205 (30%)
GST_N_Theta 3..78 CDD:239348 25/74 (34%)
GST_C_Theta 92..221 CDD:198292 34/134 (25%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.