DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:227 Identity:52/227 - (22%)
Similarity:94/227 - (41%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |:.:.::|..||...|...:.|....:.:|.|.:.....|.....||.:||...||..||....:
plant     1 MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 WDSHAISAYLVSKYG-------QSDTLYPKDLLQRAV--------------VDQRLHFESGVVFV 109
            ::|.||:.|:..:|.       |:|:   |::.|.|:              |..:|.||.  :| 
plant    66 FESRAITQYIAHRYENQGTNLLQTDS---KNISQYAIMAIGMQVEDHQFDPVASKLAFEQ--IF- 124

  Fly   110 NGLRGITKPLFATGQTTIPKE--RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALA 172
            ..:.|:|     |.:..:.:|  :...|:::|   |..|....::||:..|:.|   :..|.|:.
plant   125 KSIYGLT-----TDEAVVAEEEAKLAKVLDVY---EARLKEFKYLAGETFTLTD---LHHIPAIQ 178

  Fly   173 VFVVIDTVKY----ANITAWIKRIEELPYYEE 200
            ..:...|.|.    ..:..|:..|.:.|..|:
plant   179 YLLGTPTKKLFTERPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 49/218 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/130 (21%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 20/73 (27%)
GST_C_Phi 96..211 CDD:198296 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.