DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:220 Identity:56/220 - (25%)
Similarity:89/220 - (40%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHA 70
            |||.|.|..|....|.|......:|.|.:|..|.....|.||..||...||.|:||...:::|.|
plant     5 LYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRA 69

  Fly    71 ISAYLVSKYGQ--SDTLYPKDLLQRAVVD-----QRLHFESGV------VFVNGLRGITKPLFAT 122
            |:||:..|:..  :|....:|..:.|:|.     :..||...:      :.|..|:|      .:
plant    70 ITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIVVPLQG------ES 128

  Fly   123 GQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYA---- 183
            ....|.:|..:.:.:|.|..|..|....::|||..|:||...:.     ..:..:.|:...    
plant   129 PNAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVP-----YTYYFMKTIHAGLIND 188

  Fly   184 --NITAWIKRIEELPYYEEACGKGA 206
              |:.||         :|:.|.:.|
plant   189 RPNVKAW---------WEDLCSRPA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 53/208 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/70 (39%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/133 (20%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 56/220 (25%)
GST_N_Phi 2..77 CDD:239351 27/71 (38%)
GST_C_Phi 92..208 CDD:198296 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.