DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and AT3G47680

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_190352.1 Gene:AT3G47680 / 823922 AraportID:AT3G47680 Length:302 Species:Arabidopsis thaliana


Alignment Length:88 Identity:25/88 - (28%)
Similarity:34/88 - (38%) Gaps:19/88 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EDDGHFIWDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQR-LHFESGV-VFVNGLRGITKPLFA 121
            |..|:..|.  .|:||    ||.|..|...:..:...:.|| .....|| .||......||.. :
plant    74 EQKGYAFWS--RIAAY----YGASPKLNGVEKRETGHIKQRWTKINEGVGKFVGSYEAATKQK-S 131

  Fly   122 TGQTTIPKERYDAVI----EIYD 140
            :||..      |.|:    |||:
plant   132 SGQND------DDVVALAHEIYN 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 25/88 (28%)
AT3G47680NP_190352.1 None

Return to query results.
Submit another query.