DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF11

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:217 Identity:55/217 - (25%)
Similarity:93/217 - (42%) Gaps:36/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYG-TEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSH 69
            :|| .:|:.|.|.. |......|.:|.:.::....|...|:.|.:.|...||.:||....:::|.
plant     5 VYGQIKAANPQRVL-LCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESR 68

  Fly    70 AISAYLVSKYGQSDT-LYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKE--- 130
            ||:.|..:||....| |..|.|..||:|||.:..|:...:...|..:...:|.      ||.   
plant    69 AIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFK------PKSGKP 127

  Fly   131 -----------RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFS------LITSITALAVFVVID 178
                       ::|.|:::|   |..|..:.::.||:.|:||.|      .|.:.|:|:..|   
plant   128 CDVALVEELKVKFDKVLDVY---ENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGLV--- 186

  Fly   179 TVKYANITAWIKRIEELPYYEE 200
             ....|:..|...|...|.:::
plant   187 -TSRENLNRWWNEISARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 54/211 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/71 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/130 (22%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 55/217 (25%)
GST_N_Phi 2..77 CDD:239351 20/72 (28%)
GST_C_Phi 91..209 CDD:198296 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.