DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF8

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:212 Identity:52/212 - (24%)
Similarity:90/212 - (42%) Gaps:24/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |:.:.::|...|........||....:.:|.:.::..|........|..||...:|.|||....:
plant    49 MASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTL 113

  Fly    66 WDSHAISAYLVSKYGQ-SDTLYPKDLLQ-RAVVDQRLHFE--------SGVVFVNGLRGITKPLF 120
            ::|.||:.||..:|.: .:.|..:|..: :|..:..|..|        |.:.|....:|:     
plant   114 FESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERVFKGM----- 173

  Fly   121 ATGQTTIP---KERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALA---VFVVIDT 179
             .|.||.|   :|....:.::.|..|..|...:|:|||..|:||...:.:|..|.   ..|:.|:
plant   174 -FGMTTDPAAVQELEGKLQKVLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDS 237

  Fly   180 VKYANITAWIKRIEELP 196
              ...::.|||:|...|
plant   238 --RPKVSEWIKKISARP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 50/207 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/121 (25%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.