DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF10

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:209 Identity:53/209 - (25%)
Similarity:93/209 - (44%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKY- 79
            :.|.:||...|:.:|.|.::.:..|...||:|...|...:|.|.|..:.|::|.||..|:..|| 
plant    14 KRAVVTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYR 78

  Fly    80 GQSDTLYPKDLLQRAVVDQRLHFES------------GVVFVNGLRGITKPL--FATGQTTIPKE 130
            .|...|..|.:.:|..|:|.|..|:            .:||.        ||  |...:..| ||
plant    79 SQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFA--------PLMGFPADEKVI-KE 134

  Fly   131 RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALA-----VFVVIDTVKYANITAWIK 190
            ..:.:.|:.|..|..|:.::::|||.:::||.:.:.....|.     ..::.|.   .:::||..
plant   135 SEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDR---KHVSAWWD 196

  Fly   191 RIEELPYYEEACGK 204
            :|.....::|...|
plant   197 KISSRAAWKEVSAK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 51/199 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/60 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/133 (22%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.