DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTF3

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:226 Identity:53/226 - (23%)
Similarity:89/226 - (39%) Gaps:42/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |:.:.::|..||...|...:.|....:.:|.|.:.....|.....||.:||...||..||....:
plant     1 MAGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 WDSHAISAYLVSKY-GQSDTLYP---KDLLQRAV--------------VDQRLHFESGVVFVNGL 112
            ::|.||:.|:..:| .|...|.|   |::.|.|:              |..:|.:|....|..||
plant    66 FESRAITQYIAHRYENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGL 130

  Fly   113 RGITKPLFATGQTTIPKE--RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITAL---- 171
            .        |.|..:.:|  :...|:::|   |..|....::||:..|:.|...|..|..|    
plant   131 N--------TDQAVVAEEEAKLAKVLDVY---EARLKEFKYLAGETFTLTDLHHIPVIQYLLGTP 184

  Fly   172 --AVFVVIDTVKYANITAWIKRIEELPYYEE 200
              .:|     .:...:..|:..|.:.|..|:
plant   185 TKKLF-----TERPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 50/217 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/132 (20%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 52/223 (23%)
GST_N_Phi 4..78 CDD:239351 20/73 (27%)
GST_C_Phi 96..212 CDD:198296 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.