DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and VARS1

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_005249419.1 Gene:VARS1 / 7407 HGNCID:12651 Length:1265 Species:Homo sapiens


Alignment Length:176 Identity:39/176 - (22%)
Similarity:72/176 - (40%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PQHTVPTLED--DGHFIWDSHAISAYLVSKYGQSDTLYPKDL-----LQRAVVDQRLHFESGVVF 108
            |...:|.||.  .|.::|.:.|:          :..|:|..|     .:.||:.|:....:....
Human    53 PPPRLPALEQGPGGLWVWGATAV----------AQLLWPAGLGGPGGSRAAVLVQQWVSYADTEL 107

  Fly   109 VNGLRGITKP---LFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITA 170
            :....|.|.|   |.::.|.  |:....|:......:|.:|..|.::||:..|:||.:.:|::..
Human   108 IPAACGATLPALGLRSSAQD--PQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLL 170

  Fly   171 LAVFVVIDTVK--YANITAWIKRIEELPYYEEACGK-----GARDL 209
            ...:|:....:  :.|:|.|.......|.:....|:     |||.|
Human   171 PFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGEVVLYSGARPL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 38/174 (22%)
VARS1XP_005249419.1 GST_C_ValRS_N 92..213 CDD:198327 25/122 (20%)
PTZ00419 283..1265 CDD:240411
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.