DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Gsto2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:205 Identity:49/205 - (23%)
Similarity:84/205 - (40%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPE-FLRKNPQHTVPTLEDDG-HFIWDS 68
            :|.....|....|:|.|.|.||.:|.:.||..:|    |: :..|:|...:|.||:.. ..:::|
Mouse    26 IYSMRFCPYSHRARLVLKAKGIRHEVININLKSK----PDWYYTKHPFGQIPVLENSQCQLVYES 86

  Fly    69 HAISAYLVSKY-GQSDTLYPKDLLQRAVVDQRLHFE----------SGVVFVNGLRGITKPLFAT 122
            .....||...| |:.  |:|.|..:||  .|::..|          ..::.:...|..|....|.
Mouse    87 VIACEYLDDVYPGRK--LFPYDPYERA--RQKMLLELFCKVPPLSKECLIALRCGRDCTDLKVAL 147

  Fly   123 GQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYA-NIT 186
            .|.....|      ||.::..|     .|..||.:::.|:.:......|.|:.:.|.|.:. .:.
Mouse   148 RQELCNME------EILEYQNT-----TFFGGDCISMIDYLVWPWFERLDVYGLADCVNHTPMLR 201

  Fly   187 AWIKRIEELP 196
            .||..:::.|
Mouse   202 LWIASMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 48/203 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/117 (20%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 20/71 (28%)