DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstD10

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:197 Identity:70/197 - (35%)
Similarity:116/197 - (58%) Gaps:5/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYE-YVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSH 69
            ||....|.|.|:..:|..|||:.:: ...|||.|:|..:||:|:.|||||:|||.|.|..:|:|.
  Fly     3 LYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESR 67

  Fly    70 AISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDA 134
            ||..|||.|||:.|.|:|||:.::|:::|||:|:.|.::.:........:|.  :....:|.|..
  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFL--KKPANEENYKK 130

  Fly   135 VIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL-PYY 198
            :...::|:.|||.|..:.||...::||.:.:.:::...| ...|..:|||:..|.:..::| |.:
  Fly   131 IEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDV-AGFDFKRYANVARWYENAKKLTPGW 194

  Fly   199 EE 200
            ||
  Fly   195 EE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 67/191 (35%)
GST_N_Delta_Epsilon 4..77 CDD:239343 33/71 (46%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/111 (25%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 33/71 (46%)
PLN02473 3..196 CDD:166114 68/195 (35%)
GST_C_Delta_Epsilon 89..205 CDD:198287 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460276
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.