DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gstt1a

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:212 Identity:60/212 - (28%)
Similarity:104/212 - (49%) Gaps:18/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDS 68
            |.||....|.|.|:..:......||:||..::..|.|....||.:.:....||.|:|....:.:|
Zfish     3 LELYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTES 67

  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNG-----LRGITKPLFATGQTTIP 128
            .||..||..|:...|..||.||.:||.||:.|.::...:..:|     .:|:   |.|.....:|
Zfish    68 IAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKVFWFKGV---LPAVTGAPVP 129

  Fly   129 KERYDAVIE-----IYDFVETFLTGHDFIAGDQLTIADF-SLITSITALAVFVVIDTVKYANITA 187
            ||:.|:.:|     :..|.:.||....||.||::::||. :::..:..:|..|.:...:.| ::|
Zfish   130 KEKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVATGVDVFEGRPA-LSA 193

  Fly   188 WIKRIEE---LPYYEEA 201
            |..|:::   :..::||
Zfish   194 WRDRVKKEVGVELFDEA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 58/205 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/72 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/125 (25%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 58/199 (29%)
GST_N_Theta 3..78 CDD:239348 23/74 (31%)
GST_C_Theta 91..217 CDD:198292 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.