DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gdap1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:274 Identity:60/274 - (21%)
Similarity:94/274 - (34%) Gaps:74/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIW 66
            ||||||....|...:..:|.:|..|:..|...::....|...|.|:|.||...||.|..|.|.|.
Zfish    38 SKLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVIC 102

  Fly    67 DSHAISAYLVSKY--GQSDTLYPK----------------DLLQ------------RAVVDQRL- 100
            |...|..||...:  .|:..|.|:                |.||            ...||..: 
Zfish   103 DPTQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTHGCILHPEITVDSHIP 167

  Fly   101 -----HFESGV-------------------VFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDF 141
                 |..:.:                   .::...|.:...||........|:..|.:..:.|.
Zfish   168 AYATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVLDQ 232

  Fly   142 VETFL-----------TGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKY------ANITAWI 189
            |||.|           :...::.||..:|||.||..::..|. |:.:.. :|      .|:..:.
Zfish   233 VETELQRRSEETPEEGSQQAWLCGDFFSIADVSLAVTLHRLK-FLGLSR-RYWGNGMRVNLETYY 295

  Fly   190 KRIEELPYYEEACG 203
            :|:.:.|.:....|
Zfish   296 ERVLDRPTFRRVLG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 56/263 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/167 (17%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 57/268 (21%)
GST_N_GDAP1 40..112 CDD:239350 24/71 (34%)
GST_C_family 193..304 CDD:295467 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.