Sequence 1: | NP_001286571.1 | Gene: | GstE8 / 37113 | FlyBaseID: | FBgn0063492 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061845.2 | Gene: | GDAP1 / 54332 | HGNCID: | 15968 | Length: | 358 | Species: | Homo sapiens |
Alignment Length: | 241 | Identity: | 49/241 - (20%) |
---|---|---|---|
Similarity: | 80/241 - (33%) | Gaps: | 79/241 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWD 67
Fly 68 SHAISAYLVSKY----------GQSDTLYP-----KDLLQRAVVDQRLHFESGVVF-----VNGL 112
Fly 113 RGITKPLFAT-------GQTT-----------------IPKER------------------YDAV 135
Fly 136 IEIYDFVETFLTGHD----------FIAGDQLTIADFSLITSITAL 171 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE8 | NP_001286571.1 | GstA | 4..196 | CDD:223698 | 48/240 (20%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 20/72 (28%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 25/138 (18%) | ||
GDAP1 | NP_061845.2 | GST_N_GDAP1 | 26..98 | CDD:239350 | 19/71 (27%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 15/80 (19%) | ||
Required for mitochondrial localization | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154567 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |