DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and CLIC6

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_016883895.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:735 Species:Homo sapiens


Alignment Length:142 Identity:31/142 - (21%)
Similarity:61/142 - (42%) Gaps:32/142 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KINTLAKETLS-PEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSDTLYPKDLLQRAVV 96
            ||....:|.|: |.:.:...||  |.....|:.::..  .||::.:....::.::.|:||:    
Human   524 KIEEFLEEKLAPPRYPKLGTQH--PESNSAGNDVFAK--FSAFIKNTKKDANEIHEKNLLK---- 580

  Fly    97 DQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIAD 161
                          .||.:...|    .:.:|.|     |:.|...:..::|..|:.||:||:||
Human   581 --------------ALRKLDNYL----NSPLPDE-----IDAYSTEDVTVSGRKFLDGDELTLAD 622

  Fly   162 FSLITSITALAV 173
            .:|:..:..:.|
Human   623 CNLLPKLHIIKV 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 31/142 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 11/44 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 18/83 (22%)
CLIC6XP_016883895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.