DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Gstt3

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:209 Identity:59/209 - (28%)
Similarity:86/209 - (41%) Gaps:31/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDS 68
            |.||....|.|.||..:.....|||::...|..|..:..:..|.:.||...||.|:|....:.:|
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAES 124

  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITK---------PLFATGQ 124
            .||..||..||...|..||:||..||.||:.|.::.     ..||....         |:| .||
  Rat   125 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQH-----TALRSCCSRAMWQKMMFPVF-LGQ 183

  Fly   125 TTIPKERYDAVIEIYD-----FVETFLTGHDFIAGDQLTIADFSLITSI-----TALAVFVVIDT 179
             .:|.||..:.:...|     ..:.||....|:.|..:::||...||.:     ....:|     
  Rat   184 -PVPPERLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIF----- 242

  Fly   180 VKYANITAWIKRIE 193
            .....:.||.:|:|
  Rat   243 ESRPKLAAWRQRVE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 59/209 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/122 (23%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 24/74 (32%)
GST_C_Theta 149..273 CDD:198292 28/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348135
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.