DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:202 Identity:64/202 - (31%)
Similarity:101/202 - (50%) Gaps:10/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTL-AKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |:|.||....|.|.|:..:...|..||:.|.|:..| |.|.|:.||.:.:..|.||.|:|....:
 Frog     4 SELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTM 68

  Fly    66 WDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGI-TKPLFAT--GQTTI 127
            .:|.|:..||..||...:..||.||.:||.||:.|.::......:|.:.. ||.:..|  |: .:
 Frog    69 AESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTILGK-EV 132

  Fly   128 PKERYDAVIEIY-----DFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITA 187
            |.|:.:||:..:     :|.|.||....|||||::::||...|..|..:....|....:...:.:
 Frog   133 PSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEERPKLGS 197

  Fly   188 WIKRIEE 194
            |.:|:.|
 Frog   198 WKQRLVE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 63/200 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/73 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/112 (28%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 26/75 (35%)
GST_C_Theta 95..221 CDD:198292 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.