DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and clic5a

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:172 Identity:34/172 - (19%)
Similarity:64/172 - (37%) Gaps:58/172 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KINTLAKETLSPEFLRKNPQHTVPTLEDD--GHFIWDSHAISAYLVSKYGQSDTLYPKDLLQRAV 95
            ||....:|.|:|.   |.|:......|.:  |:.|:..  .|||:.:...:::....|.||:   
Zfish    83 KIEEFLEEMLAPP---KYPKLAAKNKESNTAGNDIFAK--FSAYIKNTKPEANASLEKGLLK--- 139

  Fly    96 VDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETFLTGHD------FIAG 154
                               :.|.|.:...:.:|.|           ::...||.:      ::.|
Zfish   140 -------------------VLKKLDSFLNSPLPDE-----------IDAESTGEEKSSNRKYLDG 174

  Fly   155 DQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEELP 196
            ::||:||.:|:..:..:.|.    :.||.|.        |:|
Zfish   175 NELTLADCNLLPKLHVVKVV----SKKYRNF--------EIP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 33/170 (19%)
GST_N_Delta_Epsilon 4..77 CDD:239343 13/45 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/112 (17%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 5/16 (31%)
O-ClC 10..244 CDD:129941 34/172 (20%)
GST_C_CLIC5 104..244 CDD:198330 27/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.