DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstD8

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:210 Identity:81/210 - (38%)
Similarity:116/210 - (55%) Gaps:9/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAI 71
            |....|.|.|:..:|..|||:......:..:..|.|.|||::.||||.:|||.|||..||:|.||
  Fly     4 YYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAI 68

  Fly    72 SAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVI 136
            ..|||.|||..|:|||.|..::|||:|||:|:.|.:|.:.:..| .|.........| |....|.
  Fly    69 LIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAI-YPQIRNNHPADP-EAMQKVD 131

  Fly   137 EIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL-PYYEE 200
            ..:..::|||...:::|||.|||||.:|:.|::...| |..|..:|.|:..|.:..:|: |.:||
  Fly   132 SAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEV-VDFDIAQYPNVARWYENAKEVTPGWEE 195

  Fly   201 ACGKGARDLVTLLKK 215
            ..     |.|.|:||
  Fly   196 NW-----DGVQLIKK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 73/189 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/69 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/118 (31%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 72/186 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 30/69 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 40/123 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460263
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.