DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstD7

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:205 Identity:81/205 - (39%)
Similarity:123/205 - (60%) Gaps:11/205 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |..|.||....:|..||.::...|||:......|||:..:.|.|||:|.|||||:|||.|:|..|
  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65

  Fly    66 WDSHAISAYLVSKYGQSDT-LYPKDLLQRAVVDQRLHFESGVVFVNGLRGITK---PLFATGQTT 126
            |:|.||:.|||.|||:.|: |||.|..:||:::|||:|:.|.::    ..:||   .:|.||:..
  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLY----DALTKYFFLIFRTGKFG 126

  Fly   127 IPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKR 191
             .:|..|.|...:.|:.|||.|.||:||.|||:||..::.:::.:..| ..|..|:.|:..|:|.
  Fly   127 -DQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWF-SFDLSKFPNVERWLKN 189

  Fly   192 IEEL-PYYEE 200
            ..:: |.:|:
  Fly   190 APKVTPGWEQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 78/196 (40%)
GST_N_Delta_Epsilon 4..77 CDD:239343 34/72 (47%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/114 (32%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 34/72 (47%)
GstA 6..188 CDD:223698 76/187 (41%)
GST_C_Delta_Epsilon 92..206 CDD:198287 37/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460328
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.