DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstD3

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:187 Identity:78/187 - (41%)
Similarity:119/187 - (63%) Gaps:5/187 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSDTLYPK 88
            |||:.:....||||..|.::|:|::.||||::|||.|:|..||:|.||..|||.|||:.|.||||
  Fly     5 ALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPK 69

  Fly    89 DLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIA 153
            |:.::||::|||:|:..:::.. |.......|.|||.. .:|.|..|.|.:||:.|||.|.|::|
  Fly    70 DIQKQAVINQRLYFDMALMYPT-LANYYYKAFTTGQFG-SEEDYKKVQETFDFLNTFLEGQDYVA 132

  Fly   154 GDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL-PYYEEACGKGARDL 209
            |||.|:||.:::.:::...| |..|..||.|:..|...:::: |.:||... ||.|:
  Fly   133 GDQYTVADIAILANVSNFDV-VGFDISKYPNVARWYDHVKKITPGWEENWA-GALDV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 72/172 (42%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/52 (50%)
GST_C_Delta_Epsilon 91..209 CDD:198287 41/118 (35%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 26/52 (50%)
GstA 6..173 CDD:223698 71/169 (42%)
GST_C_Delta_Epsilon 72..188 CDD:198287 42/120 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460341
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.