DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gstt1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:207 Identity:66/207 - (31%)
Similarity:101/207 - (48%) Gaps:19/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            |::|.||....|.|.|:..:...|..||:...::.....|.|:.|:.:.|....||.|:|...|:
 Frog     1 MAELTLYLDLLSQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFM 65

  Fly    66 WDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNG-----LRGITKPLFATGQT 125
            .:|.|:..|:..|:..:|..||.|:.:.|.||:.|.::......||     ::.:| ||. .||.
 Frog    66 AESTAMLLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCLT-PLI-LGQE 128

  Fly   126 TIPKERYDAVIEIY-----DFVETFLTGHDFIAGDQLTIADFSLITSI---TALAVFVVIDTVKY 182
            . |.|:.|||:..:     :|.|.||....|||||::::||...|..|   .|..:.|..|..|.
 Frog   129 A-PAEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFDDRPKL 192

  Fly   183 ANITAWIKRIEE 194
            |   ||.||:.|
 Frog   193 A---AWKKRVVE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 65/204 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 39/117 (33%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 21/74 (28%)
GST_C_Theta 92..217 CDD:198292 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.