DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gsto1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:199 Identity:52/199 - (26%)
Similarity:74/199 - (37%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPE-FLRKNPQHTVPTLE-DDGHFIWDS 68
            ||.....|..:..:|.|.|.||.|:.:.||...|    |: ||.|||...||.|| ..|..|::|
Zfish    25 LYSMRFCPFAQRTRLVLNAKGIKYDTININLKNK----PDWFLEKNPLGLVPVLETQSGQVIYES 85

  Fly    69 HAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGV------VFVNGLRGITKPLFATGQTTI 127
            .....||...|.:. .|.|.|..:||.....|...|.|      :.||..:|       ...:.:
Zfish    86 PITCEYLDEVYPEK-KLLPFDPFERAQQRMLLELFSKVTPYFYKIPVNRTKG-------EDVSAL 142

  Fly   128 PKERYDAVIEIYDFVETFLTGHD-FIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKR 191
            ..|..|   ::..|.|..|.... |..||.:|:.|:.:                     ..|.:|
Zfish   143 ETELKD---KLSQFNEILLKKKSKFFGGDSITMIDYMM---------------------WPWFER 183

  Fly   192 IEEL 195
            :|.:
Zfish   184 LETM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 52/199 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/112 (19%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 26/71 (37%)
GstA 25..210 CDD:223698 52/199 (26%)
GST_C_Omega 107..229 CDD:198293 21/112 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.