Sequence 1: | NP_001286571.1 | Gene: | GstE8 / 37113 | FlyBaseID: | FBgn0063492 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002561.2 | Gene: | clic2 / 436834 | ZFINID: | ZDB-GENE-040718-299 | Length: | 239 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 41/207 - (19%) |
---|---|---|---|
Similarity: | 77/207 - (37%) | Gaps: | 62/207 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQ--HTVPTLEDDGHFIWDSHA 70
Fly 71 -ISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDA 134
Fly 135 VIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYAN---------ITAWIK 190
Fly 191 RIEELPYYEEAC 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE8 | NP_001286571.1 | GstA | 4..196 | CDD:223698 | 40/199 (20%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 18/71 (25%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 20/121 (17%) | ||
clic2 | NP_001002561.2 | O-ClC | 11..238 | CDD:129941 | 41/207 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589564 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |