DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and clic2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:207 Identity:41/207 - (19%)
Similarity:77/207 - (37%) Gaps:62/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQ--HTVPTLEDDGHFIWDSHA 70
            ||  :||......||..     :::||....:.||:|      |:  |..|..::......|..|
Zfish    66 GT--NPPFLLYNGTLKT-----DFIKIEEFLETTLAP------PRYPHLSPRYKESFDVGADIFA 117

  Fly    71 -ISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDA 134
             .||::  |...::..:.|.||:        .|:....::|      .||         ::..|.
Zfish   118 KFSAFI--KNSPNNAFHEKALLR--------EFKRLDDYLN------TPL---------QDELDQ 157

  Fly   135 VIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYAN---------ITAWIK 190
            .|.:        :...|:.|::||:||.:|:..:..:.|    ...||.|         :..:::
Zfish   158 NISV--------SKRKFLDGNRLTLADCNLLPKLHVIKV----AARKYCNFDIPTQFTGVWRYLQ 210

  Fly   191 RIEELPYYEEAC 202
            ...|...:.:.|
Zfish   211 SAYEREEFSQTC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 40/199 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/71 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/121 (17%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 41/207 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.