DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstD11

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:223 Identity:82/223 - (36%)
Similarity:119/223 - (53%) Gaps:11/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFI 65
            ||..:||....|||.|:..|....|.|.:|...:|.|..|.|.|:|:..||||.|||:.|:|..:
  Fly    22 MSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVL 86

  Fly    66 WDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKE 130
            |:|.||.:|||:.||:||.|||.|:..||:|||||.|:.|.:::.    :|...|.|.....|.:
  Fly    87 WESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMR----LTDYYFPTMFIGAPLD 147

  Fly   131 --RYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIE 193
              :...:.|...::.|.|.|..|.|.|..||||.:|:.:::.|..| ..:...|.:|..|:.|.:
  Fly   148 EGKRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAF-EFELRPYKHIRQWLDRCK 211

  Fly   194 E--LPY-YEEACGKGARDLVTLLK-KFN 217
            :  .|: |||.....|..|..:.| |.|
  Fly   212 DHMAPFDYEELNANKANMLADMFKAKMN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 71/195 (36%)
GST_N_Delta_Epsilon 4..77 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/122 (30%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 112..231 CDD:198287 36/123 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.