DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and clic5b

DIOPT Version :10

Sequence 1:NP_611330.2 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:75 Identity:18/75 - (24%)
Similarity:33/75 - (44%) Gaps:12/75 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 RGITKPLFATGQ---TTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVF 174
            :|:||.|....:   :.:|.|     ::.....|...:...|:.|:.||:||.:|:..:.    .
Zfish   297 KGLTKALKKLDEYLNSPLPDE-----VDADSMEEEKASNRRFLDGNDLTLADCNLLPKLH----I 352

  Fly   175 VVIDTVKYAN 184
            |.:...||.|
Zfish   353 VKVVAKKYRN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_611330.2 GstA 4..209 CDD:440390 18/75 (24%)
clic5bNP_998062.1 EFh_CREC <53..150 CDD:330175
EF-hand motif 81..119 CDD:320021
EF-hand motif 126..150 CDD:320021
O-ClC 172..407 CDD:129941 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.