DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gstt2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:170 Identity:54/170 - (31%)
Similarity:79/170 - (46%) Gaps:19/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLV 76
            |.|.||..:.|....||:...:|.....|..:|||.:.||...||.|||:|..:.:|.||..||.
Zfish    15 SQPCRAVLIFLKHNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYLA 79

  Fly    77 SKYGQSDTLYPKDLLQRAVVDQ---------RLHFESGVVFVNGLRGITKPLFATGQTTIPKERY 132
            :.|...|..|||...:||.||:         |:|  :..||   .:.:..||. |||.....:..
Zfish    80 TTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMH--AATVF---WQEVLLPLM-TGQPANTAKLE 138

  Fly   133 DAVIEI---YDFVET-FLTGHDFIAGDQLTIADFSLITSI 168
            .|:.::   .|.:|. ||....|:.||.:::||...|..:
Zfish   139 KALSDLSGTLDKLENMFLKRQAFLCGDDISLADLLAICEL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 54/170 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/64 (39%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/91 (26%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 25/66 (38%)
GST_C_Theta 95..220 CDD:198292 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589537
Domainoid 1 1.000 50 1.000 Domainoid score I11638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.