DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and se

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:217 Identity:60/217 - (27%)
Similarity:92/217 - (42%) Gaps:38/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEF-LRKNPQHTVPTLE---DDG-H 63
            |.||.....|..:...|.|.|..|||..:.||...|    ||: |.||||..||.||   :.| .
  Fly    22 LRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDK----PEWLLEKNPQGKVPALEIVREPGPP 82

  Fly    64 FIWDSHAISAYLVSKYGQSDTLYPKDLLQRA---VVDQRLHFESGVVFVNGLRGITKPLFATGQT 125
            .:.:|..|..||..:| ....|||:|.|::.   ::.:|.....|..|.....|..:| |.:|  
  Fly    83 VLTESLLICEYLDEQY-PLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEP-FWSG-- 143

  Fly   126 TIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVV-------IDTVKYA 183
                      ::||: .|....|.:|..|:|..|.|:.:......|.:..:       .|..::.
  Fly   144 ----------LDIYE-RELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFP 197

  Fly   184 NITAWIKRIEELP----YYEEA 201
            .:|.|::|::..|    :|.||
  Fly   198 QLTLWLERMKRDPAVMAFYMEA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 56/206 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/77 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/125 (21%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 28/76 (37%)
GstA 22..215 CDD:223698 57/211 (27%)
GST_C_Omega 109..229 CDD:198293 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.