DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstT1

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:215 Identity:63/215 - (29%)
Similarity:101/215 - (46%) Gaps:17/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTE-ASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHF 64
            |||.|.|..: .|.|.||..:.:.....|:|...:....:|.|:.|:...|....||.:.|....
  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65

  Fly    65 IWDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRL---HFESGVVFVNGLRGITKPLFATGQTT 126
            :.:|.:|..||..|...|:.||||.|.:||.||:.|   ||...:|.....|.:.. |.|.|...
  Fly    66 LGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWL-LPAKGLAP 129

  Fly   127 IPKERYDAVIEIYDFVETFL-------TGHDFIAGDQLTIADFSLITSITALAVFVV-IDTVKYA 183
            .||.  ::|.::...||:.|       ...||:.||:||:||....:.|..:.:... ::..::.
  Fly   130 APKP--ESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFP 192

  Fly   184 NITAWIKRIEEL--PYYEEA 201
            .:..|::|:.:.  |||:||
  Fly   193 KVAKWMERVRDATNPYYDEA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 55/205 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/73 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/124 (27%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 55/201 (27%)
GST_N_Theta 5..80 CDD:239348 19/74 (26%)
GST_C_Theta 93..218 CDD:198292 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460098
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.