DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstE13

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:217 Identity:80/217 - (36%)
Similarity:118/217 - (54%) Gaps:11/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLED-DGHF 64
            |||..||....|||.||..|....:|:..|...::...||.||.||::.||||.:|...| ||..
  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65

  Fly    65 IWDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFAT----GQT 125
            ..|||||..:||:||..:|.|||:||.:||.:|.|:|:|:||:|     .:.|.:.|.    |:.
  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLF-----QVVKDIVARNIYGGEG 125

  Fly   126 TIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIK 190
            .............|..:|.||....|:.|::|::||.|:.|::..|.:.:.::..||.....|::
  Fly   126 EYNPRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWME 190

  Fly   191 RIEE-LPYYEEACGKGARDLVT 211
            |::: ||..||...||||.|.|
  Fly   191 RMDKLLPDNEEINLKGARALQT 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 67/197 (34%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/73 (41%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/122 (30%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 30/73 (41%)
GST_C_Delta_Epsilon 92..211 CDD:198287 36/123 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467999
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.