DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Clic

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:164 Identity:36/164 - (21%)
Similarity:61/164 - (37%) Gaps:44/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKINTLAKETLSPEFLRKNPQHT-VPTLEDDGHFIWDSHAISAYLVSKYGQSDTLYPKD-----L 90
            :|:.|:..:...|:| |.|.:.| .|.|.|:|..|.::..|..:::........|:.:|     |
  Fly    61 LKVTTVDMQKPPPDF-RTNFEATHPPILIDNGLAILENEKIERHIMKNIPGGYNLFVQDKEVATL 124

  Fly    91 LQRAVVDQRLHF-----ESGVVFVNGLRGITKPL------FATGQT-------TIPKERYDAVIE 137
            ::...|..:|..     ......::.||.|...|      |.||.|       .:|:.:      
  Fly   125 IENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFLTGDTMCCFDCELMPRLQ------ 183

  Fly   138 IYDFVETFLTGHDFIAGDQLTIADFSLITSITAL 171
                       |..:||..  ..||.:.|.:|||
  Fly   184 -----------HIRVAGKY--FVDFEIPTHLTAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 36/164 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 13/45 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/99 (20%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 13/51 (25%)
O-ClC 21..231 CDD:129941 36/164 (22%)
GST_C_CLIC 118..232 CDD:198307 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.