DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GstT4

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:213 Identity:59/213 - (27%)
Similarity:94/213 - (44%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQ--HTVPTLEDDGHFIWDSHAISAYLVSK 78
            ||..:.|.|..||:|.:.|:.|..|.|:.|| |.|..  ..:|.:.|.|:.:.::.||..:|..:
  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGEF-RDNVNRFRKLPAITDHGYQLSENVAIFRHLARE 80

  Fly    79 YGQSDTLYPKDLLQRAVVDQRLHFES---GVVFVNGLRGITKPLFATGQTTIPKERYDAV----- 135
            ....:..||:..|.|:.:|:.|.::.   ||......:  .|.|....|.|.|.:  :||     
  Fly    81 KLVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQ--QKWLVPYLQKTRPAD--NAVNLASK 141

  Fly   136 -IE--IYDFVETFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITA---------W 188
             :|  :.:|.:.||....|:.||.::.||.|.|..         ||..|.....|         |
  Fly   142 QLEHTLNEFEQLFLNSRKFMMGDNISYADLSAICE---------IDQPKSIGYNAFQNRNKLARW 197

  Fly   189 IKRI-EEL-PYYEEACGK 204
            .:.: ||| |:|:|..|:
  Fly   198 YETVREELGPHYKEVLGE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 55/203 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/62 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/136 (26%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 21/63 (33%)
GST_C_Theta 95..220 CDD:198292 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.