DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and Clic6

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:142 Identity:31/142 - (21%)
Similarity:60/142 - (42%) Gaps:32/142 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KINTLAKETL-SPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSDTLYPKDLLQRAVV 96
            ||....:|.| .|.:.:...||  |.....|:.::..  .||::.:....::.:|.|:|| ||: 
  Rat   451 KIEEFLEEKLVPPRYPKLGTQH--PESNSAGNDVFAK--FSAFIKNTKKDANDIYEKNLL-RAL- 509

  Fly    97 DQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIAD 161
                                |.|.:...:.:|.|     |:.|...:..::...|:.||:||:||
  Rat   510 --------------------KKLDSYLNSPLPDE-----IDAYSTEDVTVSQRKFLDGDELTLAD 549

  Fly   162 FSLITSITALAV 173
            .:|:..:..:.:
  Rat   550 CNLLPKLHIIKI 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 31/142 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 11/44 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 17/83 (20%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 31/142 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.