Sequence 1: | NP_001286571.1 | Gene: | GstE8 / 37113 | FlyBaseID: | FBgn0063492 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350632.1 | Gene: | GSTZ1 / 2954 | HGNCID: | 4643 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 58/201 - (28%) |
---|---|---|---|
Similarity: | 89/201 - (44%) | Gaps: | 9/201 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLILYGTEASPPVRAAKLTLAALGIPYEYVKINTL--AKETLSPEFLRKNPQHTVPTLEDDGHFI 65
Fly 66 WDSHAISAYLVSKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKE 130
Fly 131 RYDAVIEIYDFVETFL--TGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIE 193
Fly 194 ELPYYE 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE8 | NP_001286571.1 | GstA | 4..196 | CDD:223698 | 56/195 (29%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 29/74 (39%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 25/111 (23%) | ||
GSTZ1 | NP_001350632.1 | maiA | 8..212 | CDD:273527 | 57/199 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |