DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and GSTT2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens


Alignment Length:221 Identity:62/221 - (28%)
Similarity:98/221 - (44%) Gaps:29/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLV 76
            |.|.||..:.....|||.|...::.:..:..|.|||:.|....:|||:|....:.:|.||..||.
Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75

  Fly    77 SKYGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGI------TKPLFATGQTTIPKERYD-- 133
            .||...|..||.||..||.|.:.|.:.:..  :.|..||      ..||..   ..:|||:.:  
Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADC--IRGTFGIPLWVQVLGPLIG---VQVPKEKVERN 135

  Fly   134 --AVIEIYDFVE-TFLTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKY------ANITAWI 189
              |:.:...::| .||....|:||.|:|:||      :.||...:....:.|      ..:.||.
Human   136 RTAMDQALQWLEDKFLGDRPFLAGQQVTLAD------LMALEELMQPVALGYELFEGRPRLAAWR 194

  Fly   190 KRIEELPYYEEACGKGARDLVTLLKK 215
            .|:|.. ...|.|.:....::::|::
Human   195 GRVEAF-LGAELCQEAHSIILSILEQ 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 59/200 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/64 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/134 (24%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 22/66 (33%)
GstA 14..210 CDD:223698 59/207 (29%)