DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE8 and gst2

DIOPT Version :9

Sequence 1:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:180 Identity:50/180 - (27%)
Similarity:70/180 - (38%) Gaps:25/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLILYGTEASPPVRAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLED---DG 62
            |:...||.....|......|.|..|.:.||.:..:....|....|.|..||...||||.|   :.
pombe     1 MAHFTLYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNND 65

  Fly    63 HFIWDSHAISAYLVSKYGQ--------SDTLYPKDLLQRAVVDQRLHFES---GVVFVNGLRGIT 116
            :.||:|.||..||..||..        .|..|.|       :.|.|.|::   ||::  |..|..
pombe    66 YTIWESDAILIYLADKYDTDRKISLSFDDPEYYK-------LIQYLFFQASGQGVIW--GQAGWF 121

  Fly   117 KPLFATGQTTIPKERY-DAVIEIYDFVETFLTGHDFIAGDQLTIADFSLI 165
            . .|..........|| :.:..:...:|..|...|::..::.||||.|.|
pombe   122 N-FFHHEPVVSAVTRYRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE8NP_001286571.1 GstA 4..196 CDD:223698 49/177 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/75 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/79 (24%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 27/79 (34%)
GstA 5..226 CDD:223698 49/176 (28%)
GST_C_Ure2p 96..219 CDD:198326 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3221
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.